PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_21190-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 88aa    MW: 10063.7 Da    PI: 9.808
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_21190-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  TRIUR3_21190-P1 14 KGPWTPEEDLMLVSYIQEHGPGNWRAVPTNTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.5E-25563IPR009057Homeodomain-like
PROSITE profilePS5129424.339965IPR017930Myb domain
SMARTSM007171.3E-131363IPR001005SANT/Myb domain
PfamPF002493.9E-171461IPR001005SANT/Myb domain
SuperFamilySSF466891.67E-221588IPR009057Homeodomain-like
CDDcd001672.88E-121661No hitNo description
Gene3DG3DSA:1.10.10.604.6E-66488IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDLMLVSYIQ EHGPGNWRAV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF NDQEEKLIVH LQALLGNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-14148827100MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519141e-133JF951914.1 Aegilops tauschii clone TaMYB31 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006482590.16e-61PREDICTED: myb-related protein 306-like
RefseqXP_009410391.14e-61PREDICTED: myb-related protein 306-like
SwissprotP813929e-59MYB06_ANTMA; Myb-related protein 306
TrEMBLM0VNU84e-61M0VNU8_HORVD; Uncharacterized protein
TrEMBLW5FCA61e-61W5FCA6_WHEAT; Uncharacterized protein
STRINGBRADI4G30220.17e-60(Brachypodium distachyon)
STRINGMLOC_34885.11e-60(Hordeum vulgare)
STRINGGSMUA_Achr7P21010_0011e-60(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.26e-59myb domain protein 96